Sequence search refers to finding virulence gene or Drug resistance gene that are of mathcing with your input sequence.

This tool will provide gene list, annotation data, horizontal gene transfer event, and KEGG pathway.

Please input a protein sequence of your interest.

An example sequence is as below:

>Test Sequence
MAFPLHSFFKRVLTGTLLLLSSYSWAQELDWLPIPYVYVAKGESLRDLLTDFGANYDATV
VVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIFKNSEVASRLIRLQESE
AAELKQALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQTAAALEQQTQIRSEKTG
ALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDATIQQVTVDNQRIPQAATR
ASAQARVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSARIEVALSIVDINADQLTELG
VDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLVDARGLDYLLARVNLLENEGSAQVV
SRPTLLTQENAQAVIDHSETYYVKVTGKEVAELKGITYGTMLRMTPRVLTQGDKSEISLN
LHIEDGNQKPNSSGIEGIPTISRTVVDTVARVGHGQSLIIGGIYRDELSVALSKVPLLGD
IPYIGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHLALGNGQDLRTGILTVDEISNQST
TLNKLLGGSQCQPLNKAQEVQKWLSQNNKSSYLTQCKMDKSLGWRVVEGACTPAQSWCVS
APKRGVL

Input your sequence data

Database
Full Sequence Threshold
Best 1 Domain Threshold